PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020365.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 200aa    MW: 22472.5 Da    PI: 9.8225
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020365.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.3e-151360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ede+l ++v++ G g W++ +   g+ R++k+c++rw +yl
      Pbr020365.1 13 KGAWSKQEDEKLTQYVEKNGEGIWRSLPLAAGLLRCGKSCRLRWVNYL 60
                     79******************************99************97 PP

2Myb_DNA-binding53.46e-1766111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Pbr020365.1  66 RGNFGEDEEDLIIRLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 111
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-20462IPR009057Homeodomain-like
PROSITE profilePS5129413.614860IPR017930Myb domain
SuperFamilySSF466895.14E-2711107IPR009057Homeodomain-like
SMARTSM007171.9E-111262IPR001005SANT/Myb domain
PfamPF002496.5E-131360IPR001005SANT/Myb domain
CDDcd001671.15E-81560No hitNo description
PROSITE profilePS5129425.9461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-2663116IPR009057Homeodomain-like
SMARTSM007172.4E-1665113IPR001005SANT/Myb domain
PfamPF002499.2E-1666111IPR001005SANT/Myb domain
CDDcd001676.42E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MRKPCCEKRK TKKGAWSKQE DEKLTQYVEK NGEGIWRSLP LAAGLLRCGK SCRLRWVNYL  60
RPNVKRGNFG EDEEDLIIRL HALLGNRWSL IAGRLPGRTD NEVKNYWNTH LRRKLIQMGV  120
DPNNHRIGHT HNIGLTKPSF GSRKVNYLSE PVDSQGDKDS DQIKPLSDST SGLESNTSCS  180
GLPDLNLDIT IGPPSSFGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27131157108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4345471e-35AB434547.1 Fagus crenata FcMYBS2 mRNA for transcription factor MYBS2, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347822.11e-146PREDICTED: myb-related protein 308-like
SwissprotP813933e-72MYB08_ANTMA; Myb-related protein 308
TrEMBLD9ZJ541e-121D9ZJ54_MALDO; MYB domain class transcription factor
STRINGVIT_14s0006g01620.t013e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-72myb domain protein 4